DPCstruct | MC48517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 137 ± 12 aa |
| Standard deviation of domain lengths | 11.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820V693 | 1-140 | AEHGPSKFIIFSLLIPFVHRDELAGQQARDALLLIMQLSNRNESIAKYIVENTNFCPILATGLSALYSDLPHRLATNNDEWFILTKQ… |
| A0A7R9FDG4 | 75-214 | SHQGPDRFIIFTLLIPFVHREGAIGHQARDALLKCISLSVMNEYVGTYIADHSDMCLVLVTGLSALYSELPRKLDVELEEWHRLTPD… |
| A0A3P7LG61 | 1-151 | None |
| A0A671YXU8 | 129-258 | None |
| A0A6G0U8M2 | 622-750 | None |
| A0A164QD89 | 217-340 | None |
| A0A4Z2BP88 | 198-323 | None |
| A0A0R3T010 | 182-331 | None |
| A0A7R9AXL2 | 196-335 | None |
| A0A7M3RUC2 | 153-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.