DPCstruct | MC48516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 210 ± 43 aa |
| Standard deviation of domain lengths | 43.03 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S4VWG7 | 66-261 | LSNADSNVETEKIQEAQEGFAECLCLNCEQNVMSKELNFEVPFSPPLPSCITKKTGKQSLRNELKTFAAHMVQQLEAFHKSQIPDYP… |
| A0A2S4VKI1 | 3-145 | LTQHLMSRFDSFYIQTMGPFPEYVASVHFRPVQAQAITHNIDLIAADKTMNTKLIGRVIGGQMLCGQVDYLAQSILDWFGGKFYQSF… |
| A0A5B0QIC5 | 10-191 | None |
| A0A5B0QBZ6 | 29-213 | None |
| A0A5B0PXI5 | 31-175 | None |
| A0A5B0PVH1 | 125-381 | None |
| A0A180GA60 | 292-509 | None |
| A0A2N5V9G5 | 33-244 | None |
| F4R643 | 81-346 | None |
| A0A2S4VW55 | 1-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.