DPCstruct | MC48515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 140 ± 8 aa |
| Standard deviation of domain lengths | 7.61 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0R342 | 660-797 | HTQLSEEERVAALMSTMIAVNQRLDSLTTGSGISTPPPSAPLSAADQLRTFRYSGVARALIRRIARLCFLTEDLETYVRDDHENSLF… |
| A0A0L0V249 | 382-506 | MMKLSKVNREGAMYYLLASLKSNNDAPEKFDFKDPVKNDIKLFIQTSLWECMVGTYSLENDPESDVLIPNSLIRMTIKFIADKPEHY… |
| A0A2N5W3U7 | 144-278 | None |
| A0A180GKK3 | 89-232 | None |
| A0A2N5V5F6 | 281-412 | None |
| A0A2N5SUF2 | 142-286 | None |
| A0A5B0NQB2 | 42-178 | None |
| A0A0C4EUQ3 | 15-162 | None |
| A0A5B0NNL1 | 604-755 | None |
| A0A2N5UA66 | 192-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.