DPCstruct | MC48514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 154 ± 12 aa |
| Standard deviation of domain lengths | 11.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146IQE1 | 218-361 | DGVTIGHPRCRIEFCRIPLRSMKDKLCPTHVHLGDRCLAHNCDQKASHGHITCDKPAHRAKEEEHERGAEPAFMDLDRRLQKDGVST… |
| A0A0C3CEX7 | 324-472 | DGVTVGRPTCGIPRCVIPLASNRHRFCPDHTSQNQLCAIVSCKQPTLQGKRTCKDPVHQSIERVHTQRQEAQFQMKEQLKRARMAHP… |
| W4KLG6 | 235-400 | None |
| A8P0J0 | 724-882 | None |
| A0A409YPC5 | 260-427 | None |
| A0A5C3Q0R6 | 201-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.