DPCstruct | MC48511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 117 ± 17 aa |
| Standard deviation of domain lengths | 16.53 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.13 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0023- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3K043 | 1-93 | MQVNLDDFLNALDEVKPAFGVAEEELKSVIQNGINKFSPPIDEIHHDGKLFVEQVRMSTWTPLVSVLIHGPPGSGKTALAASIAQAS… |
| A0A0F8C283 | 1-104 | AFGTNQEDYSSYIMNGIIKWGDPVTHVLDDGELLVQQTKNSDRTPLVAVLLEGPPHSGKTALAAKIAEDSQFPFIKICSPDKMIGHS… |
| A0A7R8VUM3 | 1-104 | None |
| A0A1X7YFN8 | 8-127 | None |
| T1GCV4 | 237-352 | None |
| A0A3P6R654 | 14-107 | None |
| A0A1D6MAT6 | 45-185 | None |
| A0A183BD43 | 1-137 | None |
| A0A2K0U900 | 531-665 | None |
| A0A183DAD2 | 10-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.