DPCstruct | MC48510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 154 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3JY89 | 8-160 | HICNRTGCTQAFSSKKQLKKHQRTVHQLQVTCKVYGQETRVTLDRQEDEAFRCPTEGCEEESEDPVRIQKHVKKCDPSRFQQARVMP… |
| A0A1E3PTV1 | 4-164 | ESTIFQCLECDHAPFDTKAKFNKHSSSKHRRAETFEFSGVAYPLTVTSDDMYACPTCMAKTASVRSLKRHMVRHRDKAQEERLSERE… |
| A0A0L6V6L8 | 2-154 | None |
| A0A1E3PDI5 | 468-624 | None |
| A0A1Y1VZ44 | 1-170 | None |
| A0A180H2C0 | 14-160 | None |
| A0A0H5R4W3 | 1-141 | None |
| A0A0H5QXI9 | 1-141 | None |
| A0A5B0P8K6 | 1-154 | None |
| A0A5B0N3J7 | 1-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.