DPCstruct | MC48507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 17.31 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1FQA5 | 3-114 | CPFCFWLEKKHGIKRPPPYPYALNIAVDTLLKQEFDDYRAKGKLHPLIVENNIQAKLFHDQNRLNQWRSNFEGIRYYDTKLEATLMG… |
| A0A2E6UR88 | 54-142 | DRVKGLVSPSIPGWTLNETTDLLLKKEFDLCREKQIPHRIFDQYDLNHIVPFMHTEIDKWRDSLHHGLKINFKNTNIILQGGVDDIW… |
| A0A7G9YU66 | 15-130 | None |
| A0A2E0LEX8 | 2-94 | None |
| A0A2J0M5C8 | 1-94 | None |
| A0A2M7QAE1 | 4-129 | None |
| A0A1I5TYJ5 | 25-140 | None |
| A0A7K0WBQ4 | 28-132 | None |
| A0A2E8EDI7 | 204-347 | None |
| A0A0G0AMZ6 | 156-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.