DPCstruct | MC48502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 159 |
|---|---|
| Mean domain length (aa) | 232 ± 45 aa |
| Standard deviation of domain lengths | 44.60 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 11.95 |
| Pfam Score | 83.00 |
| Assigned Pfam label(s) | CL0403- CL0489- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535DN09 | 19-238 | RCQFLGARTLSVAFETTSAAVRALLPPPLEPTAEPLGLASIGEVSSSNCVGAFKSGGLFIRARYRDIIGNYCLVMPTSTPEAMTFGR… |
| A0A100XE42 | 9-208 | AQRMIDYSGLEVCQYRPGKAVVNLMLARYFDGDLGQYHEFGTAVMVNPRGSHGHGLKAFGRAAAFIHHLPVDQDFTLEAGQKIWGFP… |
| A0A6G1F2C4 | 28-187 | None |
| A0A4U0V5T2 | 183-444 | None |
| A0A6J4LYI3 | 1-158 | None |
| A0A316ZN32 | 223-497 | None |
| S7QL42 | 2-229 | None |
| M9LYJ9 | 221-498 | None |
| A0A449G658 | 53-282 | None |
| A0A2P4ZJ45 | 111-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.