DPCstruct | MC4850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 236 ± 22 aa |
| Standard deviation of domain lengths | 22.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2LG65 | 118-355 | SGSWELVSSRFARVAPLKHEFPNALAPFALEVLPGGMSVEFRETGGRRDARVLSVGGPGPECAVLQQRLRELFPEGPIVSLTPPMPL… |
| A0A814GM23 | 36-265 | QGGSTANEEHALCSQPFDSLGPFDIQPVTISFEMIPATCQYTILSIGNQRLRTEERATGYYAPIAQITLEGSARSTANIPDHATHFC… |
| A0A1Q9CNG1 | 900-1133 | None |
| A0A7S2VSV8 | 103-363 | None |
| A0A821QGR9 | 1-187 | None |
| A0A813TTX0 | 56-253 | None |
| E9AHE9 | 457-760 | None |
| A0A0M0K3Q1 | 10-240 | None |
| A0A0M0KAJ3 | 3-251 | None |
| R1DSH2 | 249-471 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.