DPCstruct | MC485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 68 ± 7 aa |
| Standard deviation of domain lengths | 7.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1WK20 | 5-81 | EQFLEDMIRCRSIEFARLGMTVEVNGVMGTIEGINRNANLDVRFTDQLEHGDNLHNCHPTWNVKYFDQNGKVIAHFD |
| A0A5C6FWL4 | 2-66 | ETIRRTRGVPAKRGGRVFDRNLGRFGTIMSARAGYLRIRLDGSRYPTCYHPTWRLDYLDDQGQVI |
| E6V1P1 | 15-81 | None |
| A0A4R1J574 | 131-219 | None |
| A0A5S4F9Z1 | 12-67 | None |
| A0A7H4HA22 | 2-65 | None |
| A0A4U0YLJ1 | 1-70 | None |
| A0A1H6UG35 | 9-67 | None |
| A0A4R7FVC5 | 1-72 | None |
| A0A3D9LM58 | 25-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.