DPCstruct | MC48499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 149 ± 28 aa |
| Standard deviation of domain lengths | 28.05 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11138 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1YNX6 | 2-153 | TQRIGISDIIIVYSRPSVNDREIWGKLVPYGMNNLGFGTAKESPWRAGANENTTIKFTDDVTIEGKPLKAGKYGLHMVINPDNSATI… |
| A0A7Y4RQX1 | 438-582 | RESPRASVSQSAGPGTIRVTYGRLRGVVATAIPLDSLWNPGADEATTVELSHAMRVAGSVVPAGRYSLIVVPGATRWTFRFHRNADR… |
| A0A523E3A1 | 5-115 | None |
| A0A7H5EUA3 | 20-172 | None |
| A0A2D7M1P1 | 18-168 | None |
| A0A0D0GFW3 | 2-81 | None |
| A0A2V5Z320 | 20-165 | None |
| A0A2V9WMR1 | 27-106 | None |
| A0A1E4AJG7 | 11-157 | None |
| A0A838T5P7 | 119-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.