DPCstruct | MC48496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 106 ± 5 aa |
| Standard deviation of domain lengths | 4.74 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 52.50 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF06792- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0R5C7 | 1-111 | MAQMAEALRQHLTARDDVAGVIGIGGSGGTALITPAMRDLDIGVPKVMVSTIACNVAPYVGPSDIAMIHSVTDVAGLNRISRRVLGN… |
| A0A7C5C079 | 87-186 | AAILVPQLYAEGKFHGIIALGGGGGTSVASAAMRALPYGVPKVIVSTVAGGDVSGYVDVKDIVMIPSVVDIAGLNRISRRVLAQAAG… |
| F0UB38 | 85-186 | None |
| A0A0A9VGR5 | 1-112 | None |
| A0A0F8WTX0 | 77-178 | None |
| A0A445EX67 | 120-228 | None |
| A0A225ACP1 | 84-195 | None |
| A0A7G6T3N9 | 384-486 | None |
| A0A453RH04 | 77-182 | None |
| A0A7J0EUQ5 | 41-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.