DPCstruct | MC48493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 608 ± 60 aa |
| Standard deviation of domain lengths | 59.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 23.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7KWK0 | 3-587 | DGGVPADRGGGGAGGRIAFATTGNTFTGVLRARGATGLADACPARHGTFNFPTNAPDMDLVVSNDIAFPPGTNWCFRSLTVTNGARV… |
| A0A1V5ZQG4 | 93-689 | IYRFDNVHVQNGGFLVMGDRLIVQEDLMVDTYGRLTHFDASNNFESRLEIYAGAVYIAETGSVNVDYRGYLGGGSGANGENHGLTLG… |
| A0A3D3GFT5 | 268-847 | None |
| A0A1Q2HR61 | 148-737 | None |
| A0A7X8LJX9 | 570-1231 | None |
| A0A7X8LJ84 | 108-785 | None |
| A0A7X6USR5 | 197-826 | None |
| A0A0G0SW48 | 443-955 | None |
| A0A7X7KX99 | 93-582 | None |
| A0A7X7KX23 | 5-573 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.