DPCstruct | MC48491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 104 ± 14 aa |
| Standard deviation of domain lengths | 14.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7KMN1 | 2-94 | ATTIWIMAGEESGDAYGARLAQALRAERPGLVVKGMGGRAMAAAGVEILLDSSELGVVGLVEVLGHLGTFVRALKALSERAAAERPA… |
| A0A7R9AJT0 | 2-91 | KRIAIIAGEVSGDLLAARLMLALRERYPECQFEGIAGAEMQAAGCQSLFPLEKLAVMGLVEVLKHLPELLAIRKQLFERWRDDPPDL… |
| A0A6M1SLT2 | 3-95 | None |
| A0A6G0XK77 | 5-100 | None |
| A0A2V7KX13 | 64-177 | None |
| G2DAI1 | 260-354 | None |
| A0A1W9SCM7 | 3-100 | None |
| A0A1W9W6Q8 | 14-114 | None |
| A0A7J7MWN4 | 8-100 | None |
| A0A2I0XAR2 | 9-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.