DPCstruct | MC4849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 109 ± 7 aa |
| Standard deviation of domain lengths | 7.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 44.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423PDH1 | 16-109 | GYRLLVAALLLALGVGSASAATMQIINGDAEGEGLNDRTPVAPVGGNDGGTRGEQRRIALQYAADILGSRLDSAVPIRIAVRFETLG… |
| A0A4R1HK69 | 4-112 | LEVIKSGIVAIFLCLCSLNAQATQIIISNLDGAGEGFNDPTAISPAGGNPGTTLGQQRLNVFEQAAKIWEAVVDSSVDIVIDAQFNP… |
| A0A3B1BUD3 | 5-115 | None |
| A0A7V1WR83 | 98-203 | None |
| A0A2M7CXC9 | 12-109 | None |
| A0A2M7CV35 | 1-118 | None |
| A0A2V8QB17 | 5-117 | None |
| A0A0N1A7I3 | 16-130 | None |
| A0A257LHX6 | 1-120 | None |
| A0A2V8LAB8 | 10-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.