DPCstruct | MC48489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 402 |
|---|---|
| Mean domain length (aa) | 551 ± 98 aa |
| Standard deviation of domain lengths | 98.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.36 |
| Mean intra-cluster sequence similarity (%) | 11.44 |
| Pfam Score | 75.07 |
| Assigned Pfam label(s) | CL0059- CL0105- CL0202- PF02884- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J1DL83 | 36-589 | KNEQMAKLNQELEGKVADSLSSISSQADRTYLWEKFSNYKMSANLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVRDSMEWMHKHV… |
| A0A7X7G3Z0 | 491-1076 | LAQLRARAVTNAGGAFAPLTRYLENEAGRAPPAPGLEDLRQEARGIPPQALAWALFGRQEHLDKARRLAADLSLRLDVERHEDIEIA… |
| A0A7V2XTJ4 | 66-636 | None |
| A0A7V3AEC3 | 348-1041 | None |
| A0A1V5ZF06 | 48-637 | None |
| A0A7X1B2G8 | 449-1048 | None |
| A0A372V0K6 | 23-680 | None |
| A0A1Q9BYU6 | 71-552 | None |
| A0A161J9B6 | 13-692 | None |
| A0A2R7SU88 | 2-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.