DPCstruct | MC48481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 101 ± 4 aa |
| Standard deviation of domain lengths | 3.75 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1PKJ5 | 12-109 | DELTQSRLEVSTLLAAGDKTHSQLLELMPERSGNAHTRNFESVLKELSTYRPPPKGSENLEQGLFVPKPVVWEQHYDPLHVLRRAVH… |
| A0A0R3WQ43 | 306-404 | ETGLIEKELVCFLAPESRKRSDLSYLLPDRCLPQNTDIIDECLQKVATYVAPSCDNMSGSLLSGHYSLKPELWHEKFDPVFYTLRMT… |
| A0A2D4K3U6 | 1-106 | None |
| A0A815T5J5 | 44-146 | None |
| A0A183M7R3 | 59-161 | None |
| A0A653BLU9 | 464-561 | None |
| A0A815X273 | 1-101 | None |
| A0A183QX35 | 108-209 | None |
| A0A183KJ20 | 305-405 | None |
| A0A7R8CH13 | 42-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.