DPCstruct | MC4848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 201 ± 28 aa |
| Standard deviation of domain lengths | 27.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7PG07 | 255-482 | IARVFEEEGLTTTGVVLIEEHAQRVKPPRMLAVPFFFGNALGEPDNPEYQHRVLQATFDLLDREQGPVLEQLPDDMVPDILMQGSET… |
| W4MBD2 | 1-229 | MLAHTFESAGLTTVGLALVREHAERMKAPRMLWVPYPFGYVLGKPNDADLQHRILAAAFDLLSCEAGPVLADFPDEEPAPVLVQASA… |
| A0A2E5SZ82 | 6-206 | None |
| A0A2D8Y1J0 | 2-176 | None |
| A0A354VK31 | 2-176 | None |
| A0A6L7NMR4 | 4-255 | None |
| A0A355DGX5 | 2-175 | None |
| A0A1F8MJZ9 | 1-173 | None |
| A0A2E5KMT9 | 1-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.