DPCstruct | MC48479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 134 ± 16 aa |
| Standard deviation of domain lengths | 16.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1IQY4 | 1-136 | MPSSREKAVKRVGEEIMDLLSKPTAKEKSLADKFKSQGGAQVMEFCPHGTRAECVRNAKTDKPGKQYECKKLHFKKIIQSHTDESLG… |
| A0A1U7LIX5 | 142-248 | SIAQDLQTLLSYKSVFDIQHSRHTEIVSLLQSPTARVKLLCQARNTEKTIRPFCTANSKRECRIRDCGKIHFIPIIKPHTETGLGDC… |
| A0A6A7FTL8 | 273-404 | None |
| A0A167E8C0 | 203-356 | None |
| A0A2J7PSJ6 | 226-380 | None |
| A0A0N1PHK6 | 1-102 | None |
| A0A7J6ZE63 | 209-340 | None |
| E9HVP9 | 2-151 | None |
| A0A830CTI7 | 19-136 | None |
| Q8I6Z2 | 408-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.