DPCstruct | MC48476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 5.44 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N0PFN4 | 1-84 | MEACNNEPACLQDRAGLEAITQLHRQLDDDANGNVDLSESDDFLREELQYDSGYEKRQRAFHHNDDMHISVKELWEAWLRSEVS |
| A0A7J5YG45 | 40-119 | CRIDEKLCNDQNEVLSYEAIRSIHKQMDDDANGNVDVSETDGFLREDLNYHDPKAKHNTFHGDDQFISVEDLWKAWKGSE |
| A0A132ABL4 | 1-81 | None |
| A0A6J3C1X8 | 72-153 | None |
| T1EKJ7 | 1-70 | None |
| A0A7F5RLW6 | 64-151 | None |
| A0A6G0J8M4 | 51-122 | None |
| A0A430Q8F6 | 58-133 | None |
| A0A834A1K8 | 51-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.