DPCstruct | MC48473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 324 |
|---|---|
| Mean domain length (aa) | 170 ± 25 aa |
| Standard deviation of domain lengths | 24.76 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N0PED8 | 698-877 | FDNQGKLLNELRMMDHTLRTGALRNNDTMEGVTQGSFRQPCADNDYLVDPEVGERILGPLQRATDVTASDIMKGRDVGLPSYNRYRQ… |
| A0A2P5B2K5 | 105-267 | LVSMGHQACGSLELWNYPLWLRDVIPQDPDGRDRPDHVDLPSLEVYRDRERSVARYNEFRRALMLIPISKWEDLTDDDEAIKTLKEV… |
| A0A2T6ZBE7 | 183-337 | None |
| A0A226EKI3 | 874-1058 | None |
| A0A7Y5DEE5 | 1-174 | None |
| A0A2K6WMI1 | 1171-1347 | None |
| A0A445D0Q0 | 350-528 | None |
| A0A4C1U5T0 | 82-267 | None |
| A0A3B4V9D5 | 222-384 | None |
| A0A194USR4 | 320-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.