DPCstruct | MC48469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 177 ± 16 aa |
| Standard deviation of domain lengths | 15.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2JK42 | 2-173 | TCSVAQTATGEPPVGRLIGKRGVLSTKEARDQHDERQRLTEVLIPQIPRLLTKYSADREKIIHLVTIPLHFQIEMYVSARLQTNLEE… |
| A0A822GKY1 | 210-383 | MLCTIRQAAECHPPVGRGTGKRVLTAKEKKSQLDDKTRLTELFAVSLPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLEA… |
| A0A2Z6P5V9 | 149-361 | None |
| A0A4D9BA71 | 158-336 | None |
| A0A0B1SNE5 | 195-375 | None |
| A0A2U1MMV9 | 48-213 | None |
| A0A6I9NHP7 | 4-162 | None |
| A0A453HW34 | 424-578 | None |
| E2LB63 | 7-202 | None |
| G7J1X1 | 97-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.