DPCstruct | MC48468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 131 ± 18 aa |
| Standard deviation of domain lengths | 18.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2JJP3 | 17-156 | AKRKSVVIEPIHINPKYNEKKYRQEFRKGFDASNKPFPHWQLRNFVENSENVVEKVEEELQNFEDWQRKENDLYSLYQSNDLKSIAP… |
| A0A3M1VN21 | 10-132 | VNKEYLNEGAMQKLHEDFKEASPFKHLEIDNFFHENILLEVIDALQDEHFERKDSDLFQFLQTDDLENSNSKFLRDFKKFLMSEDFM… |
| A0A3P7IHX1 | 4-114 | None |
| A0A4Z2DK00 | 53-184 | None |
| A0A1B6HDE3 | 1-125 | None |
| A0A1I7WV45 | 20-130 | None |
| A0A5C6NN66 | 20-160 | None |
| A0A3P7NLH1 | 106-230 | None |
| F1KZR8 | 44-147 | None |
| A0A553PDW9 | 438-584 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.