DPCstruct | MC48467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 156 ± 12 aa |
| Standard deviation of domain lengths | 12.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2JI81 | 1-127 | MVPRLLDTHALVHKEINGQKISCRELLEYFKAYMRIFKGQDLPEPKSMLMATAEANNLAAVASSRAVYQKLMEEVCGGDTPYMSTNE… |
| A0A812UM23 | 13-167 | TGKVADISRDFVRFMDLYVRDVFTTGLSTKKILGSELSTMTFPIVLRDFVNAFHDAAPAAMSFTQAMTNCTVLLAKESAMKSFIKKM… |
| A0A0L7LBC0 | 66-218 | None |
| T1HDJ8 | 316-486 | None |
| A0A2R7VUD1 | 163-319 | None |
| A0A2A2LYL7 | 122-280 | None |
| A0A7D9HIM9 | 283-440 | None |
| I4DNP0 | 46-210 | None |
| A0A3S3QDA1 | 300-441 | None |
| A0A1I7X9R6 | 622-779 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.