DPCstruct | MC48465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 291 ± 38 aa |
| Standard deviation of domain lengths | 38.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2JFJ0 | 33-286 | SPKKRKLCEQKSSPFSSDVAVQTDPFPNETKPPIRAPKEDKWTPAAFMKKACLDSATGKLLSLVDCEKNIDHLLKCTKPVDYYPLVE… |
| A0A1I7URF8 | 115-382 | TSNIITPARNPFEIEQTRQPSYMKKMLKTVSEPVMTEDSSDERPETIDARWDPIGFAMRNLYDMKRGVPLSRPQCEEQIATKLSKNN… |
| A0A2H2HYL8 | 6-249 | None |
| A0A2H2JJM9 | 36-353 | None |
| Q22779 | 1-234 | None |
| G0PN12 | 1-324 | None |
| K7HFY1 | 1-323 | None |
| A0A2A2JZ75 | 284-627 | None |
| A8XYJ1 | 279-615 | None |
| A0A1I7T2A2 | 620-928 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.