DPCstruct | MC4846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139X3D8 | 1-80 | MTPKLMIEPSYWLGTGIKLEKIDNLNLFKFTDEMQARSDELLKRSKSGLIKPEEQAELDGISELAHIFTYANSILVAESK |
| W4LLA6 | 1-67 | MAEHLQVERQDGLTLFKFTDTAQARLEVLLTRRQEFGLASDEQAELDALAELDRIFTYINSQLALAN |
| B4W2B4 | 44-121 | None |
| A0A5P8VXN0 | 50-130 | None |
| B0JXI5 | 106-182 | None |
| A0A2H2XGX4 | 2-73 | None |
| A0A0P8DD23 | 41-126 | None |
| A0A0C2QL89 | 9-85 | None |
| A0A1Z4TVL1 | 38-114 | None |
| A0A3S1APE7 | 31-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.