DPCstruct | MC48457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 249 ± 34 aa |
| Standard deviation of domain lengths | 33.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060X7T7 | 456-756 | DYDDVLDSDPLREKKEMAFAQNYLNRVCHALQEVPGRVKEFLEVLYEFEQDGDEHTSVELFTRLKPVLNEWPELLRDFAAFLHLEQA… |
| A0A0C2DFK3 | 1-214 | MGLEMMQNQPHRSRQMQNLARKIADDIKQRTFMHEDVWRTVEKIVLGDDNLEAQFDRLKAALLPKHADVLALLSLLTDDAILPPELL… |
| H2L7R1 | 868-1137 | None |
| A0A183CN72 | 17-264 | None |
| A0A0K0DQE9 | 189-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.