DPCstruct | MC48453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 228 ± 27 aa |
| Standard deviation of domain lengths | 26.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.68 |
| Pfam Score | 40.00 |
| Assigned Pfam label(s) | PF16547- PF16507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2IV61 | 12-231 | LRLESEVDKNFQKILNGLIAAFLSENHLETTDYYDMLEKHLHHFGLRISKAYFLNLTRFFYEIIIKENQLIGLLRYACGALSKMAEL… |
| A0A0K9PEU0 | 50-255 | PIIDIFLKVRSDISLEDVDTLLVFGFEVFHASQNNLYAQVRWGFILTKLLKKFGKKLPVKVQWRPFYECLVKTHFKRNTGPEGWRLR… |
| A0A553N0R4 | 28-253 | None |
| A0A3Q0JH44 | 20-291 | None |
| A0A0D8XVV1 | 89-367 | None |
| A0A0N4W9W4 | 3-213 | None |
| A0A183MWF2 | 2-246 | None |
| M8AQF5 | 3-237 | None |
| A0A814KRI4 | 55-287 | None |
| C1GVY2 | 560-770 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.