DPCstruct | MC48451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 75 ± 6 aa |
| Standard deviation of domain lengths | 6.30 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.70 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0357- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2IU73 | 1-70 | MRKRREKKLETKLKEMTFGGSLKVYGAEVVPTRPYVSILAEINETAERILAAALEKYGLERQFDDFILVE |
| A0A232FDH7 | 1-82 | MRRRRQQKLERKLQQFRSKDGGPDTGGTLKIYGEALCKDVPYKTLLLSIRDSAAQVVREMLAKYGLEKVDPQQYCLVQVSGA |
| A0A060Y8N4 | 177-258 | None |
| A0A8B6GTV6 | 135-203 | None |
| A0A077ZCJ2 | 211-275 | None |
| A0A158PJV2 | 160-232 | None |
| A0A7J5YN56 | 1-68 | None |
| A0A183MBR4 | 83-163 | None |
| A0A226PA47 | 17-90 | None |
| A0A7I1A5Q2 | 70-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.