DPCstruct | MC48450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 158 ± 13 aa |
| Standard deviation of domain lengths | 13.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2ITQ7 | 1-181 | MGILSVKALARIVVSAPHFNYSTNIISSLTYFSILKRNPNSTLLEPVLEGLSKFAHFLSIEFYEDIVSTMENMVQNEHLKTLDQLHC… |
| A0A1I7X0H8 | 1-165 | MKHVFQCYFSILKRMPNLALLEPVLEGLSKFAHLLNVEFFEDIIVTMEDLVDKQHLNILDQLHCVNTVFVILSGDGQLLNVDPSRFY… |
| A0A0N5A7P4 | 1-170 | None |
| E2BNG6 | 752-892 | None |
| A0A183EHP8 | 242-377 | None |
| A0A3R7PWC1 | 471-632 | None |
| A0A336M7G6 | 514-675 | None |
| A0A0D2VFZ8 | 651-807 | None |
| A0A5K1V668 | 3-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.