DPCstruct | MC48449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 229 ± 12 aa |
| Standard deviation of domain lengths | 11.61 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 39.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2ISS0 | 1-242 | MLIETNRLCHSLLSEVLHSIASFDDLLQEANHAVNSPHGRITLHVFWELMYDFVPNFVYNGSTHRFIRSRHVFRKTPAREKPPQVGQ… |
| A0A6F9BPF6 | 2-215 | FREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGP… |
| A0A5B7DH87 | 773-1016 | None |
| A0A3P7YBM3 | 4-242 | None |
| A0A183R869 | 175-413 | None |
| X6MM33 | 603-833 | None |
| A0A183KT23 | 2-230 | None |
| A0A484MFB7 | 30-244 | None |
| I1NCF6 | 800-1036 | None |
| A0A1B0D9A9 | 314-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.