DPCstruct | MC48448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 174 ± 16 aa |
| Standard deviation of domain lengths | 16.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2IS95 | 6-163 | NLYIIPNDSPVCQLDATDAFKTLSETERKYAHFVAKASFDGALSVFLQVSPESAAIFYVLYKLFKAEPTGQLKAKALSVGFTEEEWM… |
| A0A0S7H9X8 | 2-187 | VDSQYYLPNDIGISALDCREAFRLLSPQEKMYAHYLSRAAWYGGLVVLLQTSPESANIFVLLQRIFRKQTPEQLEQVAKAAGLSSED… |
| A0A2I2GN81 | 9-190 | None |
| A0A4W3GLX6 | 2-163 | None |
| A0A179H667 | 439-579 | None |
| A0A5E4PZ76 | 1-194 | None |
| A0A7R9Q1Z3 | 1-192 | None |
| A0A2R6WYR9 | 22-184 | None |
| A0A7R8A8G6 | 4-172 | None |
| A0A183WSF4 | 160-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.