DPCstruct | MC48442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 56.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067KMN6 | 1-79 | MRNQENDKFTVSQDDEKEEVERKILTLQRIVPGGESLGIDKLFEETVGYILTLQCQIKAMRLLESFLEEMEKEKRKFGG |
| A0A3P6GFY9 | 38-106 | NATTSVSESDVEDDDDEEAVEEKIETLQTIVPGGTALEVDELFEETASYILALQCQIKAIKVLTAFLER |
| A0A835N682 | 111-190 | None |
| A0A6J1JLR0 | 33-121 | None |
| A0A6A5LXC2 | 44-129 | None |
| A0A834LN21 | 48-129 | None |
| A5CAK3 | 62-160 | None |
| A0A6A6KQW3 | 1-84 | None |
| A0A7J6HSI8 | 54-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.