DPCstruct | MC48441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 163 |
|---|---|
| Mean domain length (aa) | 109 ± 25 aa |
| Standard deviation of domain lengths | 24.63 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01985 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067KL54 | 1-114 | MTEEERECFRKIGLKMHSSLVLGRRGVFDGVMEGLHQHWKHREVVKVITMQRIFSQVIRTAKFLEAESGGILVSVDKLKEGHAIIIY… |
| A0A838IKT3 | 16-107 | SPKLSGKQRSHLRGLAHALKPIVLVGHKGVTEALIENLDAALLAHELVKVKVHEGDDIEEVATRLAKDSSAQLAQMIGHVLVYYRAH… |
| D7U8D5 | 101-235 | None |
| A0A5D2L6H1 | 34-122 | None |
| A0A7S4A840 | 182-285 | None |
| A0A0B0PE08 | 9-125 | None |
| A0A453E6D9 | 55-160 | None |
| A0A022QTT1 | 93-208 | None |
| A0A166C816 | 589-819 | None |
| A0A834SDR5 | 74-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.