DPCstruct | MC4844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 148 ± 21 aa |
| Standard deviation of domain lengths | 20.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 15.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V6TBP6 | 78-213 | IDLDREVLCKIKELIPMDYARNFFERYDFGSGGFPFENIRILHDFIETEGNPEFEFTDNDLEKIRINLLEDLKKLNRILAEHTVRAS… |
| A0A2A5F7H4 | 20-151 | IIRAREIIGYHKEQLKYILRDHDHGNAIEPEYLREVSLLAHDLSDIHFFFNNKKLQIGLDTFEASLTEFRNFFAGNSCYDKFGSVML… |
| A0A7V2KQG7 | 44-227 | None |
| A0A7G8E827 | 32-168 | None |
| A0A2T5BX17 | 8-145 | None |
| A0A4Q0UKK6 | 2-193 | None |
| A0A0F9Y3H1 | 98-262 | None |
| A0A160TJ92 | 2-129 | None |
| A0A3C2A701 | 60-214 | None |
| A0A1G4PWE1 | 98-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.