DPCstruct | MC4843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 132 ± 8 aa |
| Standard deviation of domain lengths | 8.44 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10094 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418VUI5 | 193-326 | DLDPLLAAHWPSGGGPGDAAAACPRGLAVLGEHPDLLADYLDRAVQTNEVQRAAVLAPALLAATALTGRPLALYEIGASAGLNLAWD… |
| A0A2A5F4M0 | 3-139 | QLADADRFWQAVDKAMRAHSDHIIGWMKSPPQTNEIRRSNALIPGFHLIAKKTDLPLVMSEIGASTGLNLNWDLFAMEIDGPVWAPD… |
| A0A6J4JM87 | 92-221 | None |
| A0A257JTF5 | 2-125 | None |
| A0A1I3EDR7 | 6-134 | None |
| A0A535EUG4 | 167-302 | None |
| A0A3P1T4T2 | 71-202 | None |
| A0A7W5B4D3 | 61-186 | None |
| A0A6G1SXI2 | 91-212 | None |
| A0A354W0V1 | 79-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.