DPCstruct | MC48429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 236 ± 47 aa |
| Standard deviation of domain lengths | 46.63 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A359HFW4 | 83-323 | RRSFRFHHSDENDEALLDELRAAGIEHLTQSDLEELSIHNVTADYVREISALGLQPESLGEWIELRIHAVTPRYVRELRDAGITDLE… |
| A0A7Y4K0B5 | 107-278 | PDADEQFLLASVNVGPKRVQALAATGQKVTTVEELVHVGIFNITPDYVRAMAAEGYAKLTLQQLVDCRIHGVTPERIQGLAALGFKG… |
| A0A1W9SJ27 | 144-417 | None |
| A0A2G2G8J8 | 71-364 | None |
| A0A1B6YED1 | 103-354 | None |
| A0A1M7PAQ5 | 130-372 | None |
| A0A2D4ZYF5 | 74-279 | None |
| A0A7C1IK30 | 80-360 | None |
| A0A2N2MDW3 | 81-383 | None |
| A0A6N8WGY6 | 4-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.