DPCstruct | MC48425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 12.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7KSK9 | 430-537 | SMNRHDPLGYDRHWRKYWFLIRRIIIEEIDGLSYISTEKQFDELMAVLDGEKWERHLVAVLNGRKDEILGHMETTELLTNERKGQRV… |
| A0A565CJ50 | 1-123 | MEKIVIRPNPLGKDRDYNRYWWFRSNGRIFVEDSDSKEWGYYTSKEELDALMGSLNRKGERELSLHIQLENFYDRICSTLQKRTKDI… |
| A0A287KD52 | 253-379 | None |
| A0A287KD01 | 127-252 | None |
| A0A3Q0JN51 | 69-174 | None |
| A0A452ZWC3 | 635-726 | None |
| M0YQL0 | 218-323 | None |
| A0A453F7N8 | 566-663 | None |
| A0A7J7C0H0 | 186-301 | None |
| A0A7I8KFB2 | 465-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.