DPCstruct | MC48424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 3.60 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 68.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6F6S4 | 106-181 | IVTNISMSSSSPDDDEDCIVAVKFLGPQLSLCKPAQRDCKWSNIRITDPSFFSSHVMYSKRDEMFSMPASRGHYIG |
| A0A565CAK4 | 1-69 | MSSSSPEEEDCVVAIKFMGPQLSLCRPAQSNSEWTNIRIRNPCFFSSPVMFSQREGMFGIPGAGGHLIG |
| A0A565BJE5 | 60-132 | None |
| A0A398AFD4 | 40-113 | None |
| A0A3N6R4B9 | 182-259 | None |
| A0A7G2FK75 | 424-498 | None |
| A0A078JCR5 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.