DPCstruct | MC48423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 191 ± 39 aa |
| Standard deviation of domain lengths | 38.58 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565C791 | 201-389 | RLEFPTIHQKNQRSVVLTKKTSHGFPDEFNLFGLSNQVPYYDHALDLILDEESSSHGEIITEEQNELIESAAEVLYGMIHARYLLTF… |
| A0A0S7H5D0 | 4-144 | DLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCM… |
| A0A1Q9ENB3 | 47-253 | None |
| A0A811MY95 | 226-413 | None |
| A0A2H3GRH1 | 1-115 | None |
| A0A7R9U1T1 | 1-171 | None |
| A0A1I8ING0 | 14-214 | None |
| A0A1I8HX14 | 847-1046 | None |
| A0A7S1UMD8 | 421-631 | None |
| V5CZP2 | 8-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.