DPCstruct | MC48422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A426XQ12 | 31-102 | IFDVNGKVLTSEGVQVVRDYGSNGYPFTDERIEKLKEEEEAAKQNQTLRSLLVTSSRDFVISKDGNKVITSH |
| A0A2U1KL81 | 79-151 | IIGPDGKTLHPNVADAIEEHGTIAYPFTPDKFAELEKIEKAKQEAQTLESVLVSGDLDFVLGKDGAKIPVSDL |
| A0A2I0K2J0 | 45-129 | None |
| A0A1J3JEY4 | 1-71 | None |
| D8R3X1 | 35-109 | None |
| A0A2J6LR73 | 125-210 | None |
| L0S3L1 | 401-474 | None |
| A0A175YIN1 | 36-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.