DPCstruct | MC48419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 62 ± 2 aa |
| Standard deviation of domain lengths | 2.13 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 92.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 59.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565BMB6 | 1-60 | MTTELGGGTGTGAAPIVVEFAKDLNVFTIGVVSMPFPMEGVQIHSQAVKSFQNLKLHVDH |
| A0A0D3EBA1 | 142-200 | FITAGMGGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQMNV |
| A0A1F4LZG0 | 1-67 | None |
| A0A383W769 | 698-759 | None |
| A0A4S4E3Q1 | 64-129 | None |
| R7KA99 | 127-188 | None |
| W7TNK1 | 580-641 | None |
| D6ZV86 | 3-61 | None |
| G9WVX7 | 98-156 | None |
| A0A0G0XLL5 | 68-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.