DPCstruct | MC48417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 111 ± 18 aa |
| Standard deviation of domain lengths | 18.36 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.32 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0123- PF13817 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G6FQG5 | 7-114 | KRNWSDAFKGRVVAETLVPGVTVNEVARRHDLRANHLSSWRRLAKDGKLVVPDLAGADFAPVVLQPAAARSVTAPEGVVEILHGSIT… |
| A0A1I2HUC2 | 1-100 | MTTQERWRAHVDAWKSSGLSCRAYAAKAGINQRTLTWWKSKLAGAGATGPTPASFVEVTEQLAAPAADVGVIELDVGGVHVRVRGRV… |
| A0A833FYE1 | 7-127 | None |
| A0A7Y5NCN6 | 11-114 | None |
| A0A4R7S4B0 | 17-128 | None |
| A0A842HCS3 | 2-88 | None |
| A0A5B7U5M4 | 16-149 | None |
| A0A410UF20 | 4-93 | None |
| A0A661NZZ2 | 1-157 | None |
| A0A363NPS9 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.