DPCstruct | MC48415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I2DPU8 | 1-139 | MGHRANFVVIEHRVARVFADQWAALECALVLQEGPAASRKWVEALEEAGGLMPSGFAEAGFLLDFDEVVMMGFGDVGADLQSLDEES… |
| A0A2P8FBU7 | 1-126 | MGSRVNYAIKSKDGLRIYHDRWGASRIPYDLYLGENAFLEYVKECTITEHLREHGWMEGFVIADIEKKLLGFWSWELEHETSVVHYF… |
| A0A518HMH9 | 3-148 | None |
| A0A7C7WT80 | 1-122 | None |
| A0A5C4Y5E7 | 30-186 | None |
| A0A1X3A1Y9 | 1-126 | None |
| A0A554GQT0 | 1-140 | None |
| A0A4R9E803 | 50-168 | None |
| A0A4U1H7N4 | 1-134 | None |
| A0A542ZPA5 | 44-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.