DPCstruct | MC48413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 179 |
|---|---|
| Mean domain length (aa) | 206 ± 51 aa |
| Standard deviation of domain lengths | 51.05 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.92 |
| Pfam Score | 69.58 |
| Assigned Pfam label(s) | PF12483- PF07787- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1VR56 | 20-200 | YVLSTDVRTRRTLKKRPVTPIRGLREGEVARVRGRVVAGERVLEAPLSNRASVYYLATVDQETGRNHWREVAREERYVEFALDDGTG… |
| I3NHA1 | 29-328 | SGGMFVGLMTFLLSFYLIFTNEGRALKTATSLAEGLSLVVSPESIHVVAPENEGRLVHIVGALRTSKLLSDPNYGVHLPAVKLRRHV… |
| A0A6B2CDA6 | 82-429 | None |
| A0A446LZV9 | 1-144 | None |
| A0A1Q9CMZ8 | 292-506 | None |
| A0A7Z7KQF7 | 2-153 | None |
| K2DB36 | 37-285 | None |
| A0A5F5Y070 | 260-472 | None |
| A0A1W9QC03 | 3-243 | None |
| A0A1G1G701 | 134-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.