DPCstruct | MC48412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1641 |
|---|---|
| Mean domain length (aa) | 204 ± 46 aa |
| Standard deviation of domain lengths | 46.01 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.53 |
| Pfam Score | 69.34 |
| Assigned Pfam label(s) | PF01556- CL0080- CL0144- CL0177- CL0200 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1T8W8 | 7-202 | YTPRTSATRVHWVLEELGVRYEKVKVDLRAGEQHKPEFLAINPNGKVPALVVDGTPMFESLAIILYLGDRFGVDKGLWPRVGTGEHA… |
| F4NFN6 | 7-192 | ACSLASHITLRESGKDFTLVSVDLMKKRLENGDDYFAVNPKGQVPALLLDDGTLLTEGVAIMQYLADSVPDRQLLAPVNSISRYKTI… |
| A0A7M3RK10 | 288-515 | None |
| A0A7M3RZH8 | 16-176 | None |
| S9S9F1 | 155-355 | None |
| A0A6A5UZN8 | 9-230 | None |
| A0A1V8T212 | 5-256 | None |
| A0A1V8SHD4 | 388-581 | None |
| I3LZX6 | 6-220 | None |
| A0A1D2MZF2 | 9-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.