DPCstruct | MC48411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15523 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A8T884 | 1-86 | MPPGDCTKDVWRDLSKAVGTACKTQSMNCDETMSCVDLTVRWNRFERCIEARRTLMNRCFRGGDLAHKGALATYERGQAECTKLIR |
| A0A497TZ78 | 47-130 | RADPGGCTPEVHEVLQDAVDEKCKILRRCKHDQSCDALLSNLRKNLDCAKAREILNSTCFDGGDNAHKQALGDARQSAWRCIDI |
| A0A2T4VG86 | 106-200 | None |
| A0A365R1Y7 | 62-154 | None |
| A0A6P1Q9H8 | 152-237 | None |
| A0A7G6DSU1 | 8-95 | None |
| A0A377DJE7 | 110-229 | None |
| A0A1V3JSF3 | 82-173 | None |
| A0A750P479 | 1-85 | None |
| G2Z5J2 | 155-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.