DPCstruct | MC48410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 127 ± 7 aa |
| Standard deviation of domain lengths | 6.74 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6BJ88 | 1-120 | MLGAWRSHSDYQSFLVENIQPIYASDKNRVLQFSEALSKLYNLDLDVLKPVLEPYYSNTGSPAKNQPEVFRSFVLMSLLKCHSITKW… |
| A0A1Y4GYM4 | 1-130 | MLPVNPGGHAAYQNFVVTNLRKYYPDPDAFSRATWDIIERFWNLDLSYTDELLRSKYSVFGPKPRTPSCMQRSYLLSIDFKVHSLTD… |
| T0PG25 | 1-120 | None |
| A0A1C6K8V8 | 1-134 | None |
| A0A1Q6JCM3 | 1-122 | None |
| A0A0D7WTN4 | 1-121 | None |
| A0A1C5U8G6 | 1-123 | None |
| A0A7V6PTF1 | 9-145 | None |
| R4KJF8 | 1-128 | None |
| R9K1K3 | 3-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.