DPCstruct | MC4841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Standard deviation of domain lengths | 10.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I6ZDM9 | 11-80 | LLAGAMPALAAVPDSCERVRSDIQQKIIQNGVAESAFTLDIVPNDQADKAGAQVVGHCANDTFKILYTRT |
| U6ZSM4 | 3-64 | SLAGTALAAGKPCEELKGEIAAKIDANGVPHYSLEVVDKGAAADGKVVGSCEAGTKEIVYKR |
| A0A1E4KAD8 | 6-75 | None |
| A0A1C0A3C7 | 1-78 | None |
| A0A2V4DZB4 | 1-79 | None |
| A0A0P9LKQ6 | 1-54 | None |
| A0A444JG83 | 9-81 | None |
| A0A519EL97 | 2-81 | None |
| A0A1V3P586 | 1-76 | None |
| A0A3B9NWP7 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.