DPCstruct | MC48403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 262 ± 49 aa |
| Standard deviation of domain lengths | 48.59 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7K553 | 6-278 | LAANEEQKNLFDYFNWTGVPDIPEEILNSLARWVLLYDVPFPYMAVREEMLPPESIRFFFLDKSYIAALLDGAMSLGRSFTIDYQHD… |
| A0A4Q5MW36 | 916-1157 | AEPDVAPEIDLPLWKFLSDNAPDWLLPGSGDIPADRVLAVQTNPPFVDAVLLGANVQTLGELRWRNLPITTRWTPLRRFWQRISVAA… |
| A0A536VQK5 | 59-341 | None |
| A0A2K0W3H8 | 12-253 | None |
| A0A1Y5SHL4 | 422-635 | None |
| A0A7K2PE46 | 2-226 | None |
| A0A6M5FZF2 | 166-382 | None |
| W9NNH6 | 528-872 | None |
| A0A0M2UZ55 | 1-172 | None |
| A0A1H3HXW0 | 367-544 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.